PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C018179P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NZZ/SPL
Protein Properties Length: 311aa    MW: 33905.1 Da    PI: 6.4363
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C018179P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE42.41.6e-131616039182
          NOZZLE  39 tkksrgrkpgsktaqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssvaaisntatrlpvpvdrgv.....vlqgfpsslgs..srilc 126
                     +k   grkpg k    +qkkp  rg+gva+ler +++e+ k ++  +        + +n    +p p  + +     +  g  + lg     +++
  MELO3C018179P1  16 PKPRAGRKPGPKNP--NQKKPPQRGLGVAQLERLRLQENWKTVTEISPPTFLLHNTLPNFPLHFP-PAPPPIlhtdcIAAGAGAVLGFdhHGFVV 107
                     455569*****975..789**********************998877777777789999999998.55544400000444555566654444555 PP

          NOZZLE 127 ggvg..sgqvmidpvispwgfvetsatthelssisnpqmynassnnrcdtcfkkkrld 182
                       +g   g +    v+     ve+s    elssi+  ++  a   +rcd cfkkkr++
  MELO3C018179P1 108 QRIGnnGGFLPAGGVLIGNTSVEASR---ELSSIP--KLPLACDSDRCDHCFKKKRVN 160
                     44441145666667777777777776...****96..5666888899*********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087442.6E-1114160IPR014855Plant transcription factor NOZZLE
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MATPLQQQTS NTSHPPKPRA GRKPGPKNPN QKKPPQRGLG VAQLERLRLQ ENWKTVTEIS  60
PPTFLLHNTL PNFPLHFPPA PPPILHTDCI AAGAGAVLGF DHHGFVVQRI GNNGGFLPAG  120
GVLIGNTSVE ASRELSSIPK LPLACDSDRC DHCFKKKRVN FSNRMKEKNI IAAAAETPSF  180
DFLGLGTNST AELNTHSVMN HHTDSGWDLD YDFSLNLKQV RGGGGDGGEG SKLMEYEFFP  240
RKNGRGTEIE ELKMPKEELS LFREENEEEE EEVLAMDHGE GSCITTSCND IINGGTRNST  300
ALDLSLKLSF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818260.0LN681826.1 Cucumis melo genomic scaffold, anchoredscaffold00032.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008454619.10.0PREDICTED: uncharacterized protein LOC103494987 isoform X1
TrEMBLA0A0A0LDJ30.0A0A0A0LDJ3_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83651723